SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006211 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006211
Domain Number 1 Region: 468-651
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.31e-28
Family cAMP-binding domain 0.0011
Further Details:      
 
Domain Number 2 Region: 14-109
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.66e-25
Family Flavin-binding PAS domain 0.00014
Further Details:      
 
Domain Number 3 Region: 196-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-22
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006211   Gene: ENSTBEG00000007180   Transcript: ENSTBET00000007192
Sequence length 951
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4198:198022:243698:-1 gene:ENSTBEG00000007180 transcript:ENSTBET00000007192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SNFLLANAQGPRGFPIVYCSDGFCELTGYGRTEVMQKTCSCRFLYGPETSEPALQRLHKA
LEGHQEHRAEICFYRKDGSAFWCLLDMMPIKNEMGEVVLFLFSFKDITQSGGPGLGPAGG
HGDSNHENSVGRRGASSKLRSARRQSRTVLHRLTGHFGRRSQGDMKTNNNVFEPKPSVPE
YKVASVGGSRCLLLHYSVPKAVWDGLILLATFYVAVTVPYNVCFAGDDDTPITSRHTLVS
DIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATWFFVDLIAALPFDLLYVFN
ITVTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFALLAHWMACVWYVIGRR
EMEANDPLLWDIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDFIRVHRLPG
PLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREILQLPLFGAASRGCLR
ALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPEP
GQEPGSGADPSCVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYGATFRAGLPRDLTF
NLRQGSDTNGFSRFSRSPRLSQPRSESLGSSSDKTLPSITEAEGGVEPGGGPRPRRPLLL
PNLSPARARGSLVSLLGEELPPFPALVSSPSLSSSRSPDQIVDGIEDSGSTAEAPTFRFS
RRPEPPRPRSQDPPTGTRPSQELATEAEEVKEKVCRLNQEXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXLPHLSPCVSGPPPSLQDTTLAEVHCPTSVGTAE
IEASPQDLRTSMLPPYPSEPDPLGHSPVPEASPSTPSLMRHTFRSRSETFH
Download sequence
Identical sequences ENSTBEP00000006211 ENSTBEP00000006211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]