SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006214 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006214
Domain Number 1 Region: 147-412
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.07e-53
Family Protein kinases, catalytic subunit 0.00000000153
Further Details:      
 
Domain Number 2 Region: 1-79
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00000000494
Family Extracellular domain of cell surface receptors 0.023
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000006214
Domain Number - Region: 71-124
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.0647
Family NadC C-terminal domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006214   Gene: ENSTBEG00000007195   Transcript: ENSTBET00000007195
Sequence length 423
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_739:1104736:1139069:1 gene:ENSTBEG00000007195 transcript:ENSTBET00000007195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFLCAPSSRTG
SVTTTYCCDKDHCNKIDLPTTVKPTPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTV
IHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSASGLPLLVQRTIARTIVLQESIGK
GRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTW
TQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRD
LKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYHDYQLPYYDVPDPSV
EEMRKVCQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEG
IKM
Download sequence
Identical sequences ENSTBEP00000006214 ENSTBEP00000006214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]