SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006381 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006381
Domain Number 1 Region: 77-161
Classification Level Classification E-value
Superfamily FKBP-like 5.89e-30
Family FKBP immunophilin/proline isomerase 0.00054
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily FKBP-like 2.55e-25
Family FKBP immunophilin/proline isomerase 0.00064
Further Details:      
 
Domain Number 3 Region: 227-273
Classification Level Classification E-value
Superfamily FKBP-like 0.00000000000000648
Family FKBP immunophilin/proline isomerase 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006381   Gene: ENSTBEG00000007395   Transcript: ENSTBET00000007384
Sequence length 273
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_4692:123:5573:-1 gene:ENSTBEG00000007395 transcript:ENSTBET00000007384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYDRDSTFNVFVGKGQLIAGMDQALVGMCVNERRFVTIPPELAYGAEGVSGVIPPNAVLH
FDVLLVDLWNAGDQVQIHTYLKPPACPRATQVSDFVRYHYNGTFLDGTLFDSSHNRMKTY
DTYVGIGWLIPGMDQGLLGMCVGEKRIITIPPFLAYGEEGDXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYSRNRTFDTYIGQGY
VIPGMDEGLLGVCIGERRRIVVPPHLGYGEEGR
Download sequence
Identical sequences ENSTBEP00000006381 ENSTBEP00000006381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]