SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006432 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006432
Domain Number 1 Region: 296-421
Classification Level Classification E-value
Superfamily ITPase-like 0.00000000000174
Family YjjX-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006432   Gene: ENSTBEG00000007438   Transcript: ENSTBET00000007439
Sequence length 452
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3034:279401:314991:1 gene:ENSTBEG00000007438 transcript:ENSTBET00000007439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXATSSFPSPNVSSMESLPPHTYSTPQ
PSPLPLVSPSPAPSAPPLATSLPPPVSSSAAFGNPPLSHFPPSTSAPSALMSAPSSGPPI
SGFSVGSTYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQASLTSVAQGAGTTSAI
TFPEEQEDPRISRGQDEASAGGLWGFIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAQ
ERIDSLRRNGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHLETFTQATPVP
LESVQQXXXXXXXXXXXXXXXXXXXXGEVLESLLNVSRTDWHAAFTGMSRRQMIYSAAKA
IAGIDPQIVAVHGVETFAAPNLVSLLFGSTVG
Download sequence
Identical sequences ENSTBEP00000006432 ENSTBEP00000006432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]