SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006594 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006594
Domain Number 1 Region: 1063-1104
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.0000000000000981
Family Nuclear receptor coactivator interlocking domain 0.0008
Further Details:      
 
Domain Number 2 Region: 123-207
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000367
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.03
Further Details:      
 
Domain Number 3 Region: 268-372
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000127
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006594   Gene: ENSTBEG00000007600   Transcript: ENSTBET00000007625
Sequence length 1458
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2769:20636:146594:-1 gene:ENSTBEG00000007600 transcript:ENSTBET00000007625 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGMGENTSDPSRAETRKRKECPDQLGPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXKAAAANIDEVQKSDVSSTGQGVIDKDALGPMML
EALDGFFFVVNLEGNVVFVSENVTQYLRYNQEELMNKSVYSILHVGDHNEFVKNLLPKSI
VNGGSWSGEPPRRNSHTFNCRMLVKPFPDSEEEGHDNQEAHQKYETMQCFAVSQPKSIKE
EGEDLQSCLICVARRVPMKERPVLPSSESFTTRQDLQGKITSLDTSTMRAAMKPGWEDLV
RRCIQKFHAQHEGESVSYAKRHHHEVLRQGLAFSQIYRFSLSDGTLVAAQTKSKLIRSQT
TNEPQLVISLHMLHRENVVMNDLTDAMKPLSLSSSSPAHPALCSGNPGQDMTLSSNMNFP
INGPKEQMGMPMGRFGGSGGMNHVSGMQAATPQGSNYALKMNSPSQSSPGLNPGQPSSML
SPRHRMSPGVAGSPRIPPSQFSPAGSLHSPVGVCSSTGNSHSYSNSSLNALQALSEGHGV
SLGSSLASPDLKMGNLQNSPVNMNPPPLSKMGNLDSKDCFGLYGEPSEGTAGQAESSCHS
GEQKEPSDPSLPPAVSSERADGQSRLHDSKGQTKLLQLLTTKSDQMEPSPLSSSLSDTNK
DSAGSLPGSGSTHGTSLKEKHKILHRLLQDSSSPVDLAKLTAEATGKELSQESSSTAPGS
EVTVKQEPVSPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKT
EKEEMSFEPSDQPGSELDNLEEILDDLQNSQLPQLFPDTRPGAPAGSVDKQAIINDLMQL
TAENSPVTPVGAQKTALRISQSTFNNPRPGQLGRLLPNQNLPLDITLQSPPGAGPFPPIR
NSSPYSVIPQPGMLGNQGMIGNQGNVGSSSTGMMGSNASRPTMPSGEWAPQNSAVRVTCA
ATTSAMNRPIQGSMIRNPTASIPMRPSSQPGQRQMLQSQVMNIXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXQTFDSSPDDLLCPHPAAESPSDEGALLDQLYLA
LRNFDGLEEIDRALGIPELVSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXAPINAQMLAQRQREILNQHLRQRQMHQQQQVQQRTLMMR
GQGLNMTPSMVAPSGMPAAMSNPRMPQANAQQFPFPPNYGMSQQPDPGFTGATTPQSPLM
SPRMAHTQSPMMQQSQANPAYQAPSDMNGWAQGSMGGNSMFSQQSPPHFGQQANTSMYNN
NMNISVSMATNTGGMSNMNQMTGQISMTSVTSVPTSGLSSMGPEQVNDPALRGGSLFPNQ
LPGMDMIKQEGDASRIYC
Download sequence
Identical sequences ENSTBEP00000006594 ENSTBEP00000006594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]