SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000006783 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000006783
Domain Number 1 Region: 19-60
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000026
Family Fibronectin type II module 0.0043
Further Details:      
 
Domain Number 2 Region: 71-104
Classification Level Classification E-value
Superfamily Kringle-like 0.0000000106
Family Fibronectin type II module 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000006783   Gene: ENSTBEG00000007842   Transcript: ENSTBET00000007838
Sequence length 104
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_115747:2881:3994:1 gene:ENSTBEG00000007842 transcript:ENSTBET00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NITHPPRDRLRILFSLDGQCIFPFRFKDELYYDCIKFKTKHKWCSLNKTFIGYWKFCNWE
XXXXXXXXXXFRRMIYRECTDVGSESGKKWCSLTKNFNKDRIWK
Download sequence
Identical sequences ENSTBEP00000006783 ENSTBEP00000006783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]