SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007329 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007329
Domain Number 1 Region: 1-89,123-168
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.81e-19
Family ADP-ribosylglycohydrolase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007329   Gene: ENSTBEG00000008465   Transcript: ENSTBET00000008459
Sequence length 215
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3366:1672:9983:-1 gene:ENSTBEG00000008465 transcript:ENSTBET00000008459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKFQAAMVLGSVGDAMGYRNVCRENSACGSDMQELLQDGGLGHLVLSAEKWPVSDNTLM
HIATAEALTTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXSGFGAATKAMCIGMRYWQPERLATLVEVSVECGRMTHNHPTXXXXXXXXXXXXX
XXXXXXXXXXCWGRDMLRAVPLAEEYCKKTIRHMA
Download sequence
Identical sequences ENSTBEP00000007329 ENSTBEP00000007329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]