SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007447 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007447
Domain Number 1 Region: 2-175
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.62e-47
Family Carbonic anhydrase 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007447   Gene: ENSTBEG00000008601   Transcript: ENSTBET00000008598
Sequence length 232
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4771:34230:129311:-1 gene:ENSTBEG00000008601 transcript:ENSTBET00000008598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILK
SKSVLSGPLPQGXEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDE
AVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKIIPCFNPNTLLPXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIEEFRRLRTHVKGAELVEGCD
Download sequence
Identical sequences ENSTBEP00000007447 ENSTBEP00000007447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]