SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007476 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000007476
Domain Number - Region: 211-251
Classification Level Classification E-value
Superfamily DNA-glycosylase 0.0248
Family Mismatch glycosylase 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007476   Gene: ENSTBEG00000008618   Transcript: ENSTBET00000008633
Sequence length 968
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1982:132925:165450:1 gene:ENSTBEG00000008618 transcript:ENSTBET00000008633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IIWLSMRGGTLYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVT
LGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTYNLRHRLEEGQATSWS
RRLKVFLCCTRTKDSQSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFALAAYGWPMYLMRKPAC
GLCQLARSCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXEDAMEYSKEFVTAEVLGKDLVPRIGLSQLEGFRRQLLDVLQRSTKPKXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXCCEQEDPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLS
AAKIMVSPTEVDLTPELIFQQQPLPTGPPMPAGLALELPAADHRNSSIRSKSQSEMSLEG
FSEGRLLSPVAAAAAARQDPVELLLLSTQERLAAELQARRAPLATMESLSDTESLYSFDS
RRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTELLAADSLSKHSQDTQ
PLEAALGSGGVTPERPTSATANEEEEEGGGGDGGAAPRGELALHNGRLGDSPSPQVLEFA
EFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILLRAQFEPNLVPKPPR
LFAGSTDPSSGISLSPSFPLSSSSELMDLTPTGLSSQECLAADKIRTSTPTGHGASPAKQ
DDLVIPAR
Download sequence
Identical sequences ENSTBEP00000007476 ENSTBEP00000007476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]