SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007528 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007528
Domain Number 1 Region: 95-232,268-393
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 4.16e-56
Family Quinoprotein alcohol dehydrogenase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007528   Gene: ENSTBEG00000008687   Transcript: ENSTBET00000008689
Sequence length 459
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_497:171344:232504:1 gene:ENSTBEG00000008687 transcript:ENSTBET00000008689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPPKGPRRFPGKTWKMAPPTVSPSALQRHNRLPWVTVVKALGGFRLSTEDTHRDHLLV
SLDPLDDRDFLVPKKDVKRETFWGDQEPLSKIPFKILSGHEHVVSSCHFCVDDTKLLSGS
YDSTVKLWDAVDGSVIQDYEPHPKAPILECSITADYRRIVAASYDKTVRAWDLETGKLLW
KMSHDNFVVSCKFSPDGKYVVAGLDVDRGIFIMDAENTATVSHIKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXAHSNAISNCCFTFSGHFLCTSSWDKNLKIWN
VHTGEFRNHGACVTLMQGHEGCVSCCSFARDSSFLISGGFDRTVAIWDVGEGYRKLSLKG
HHDWVMDVAISNNKKWVLSASKDRTMRLWNIEEIDQIPAVMEYKKAKGITARQCEGCDKP
FSIFENNTSSEIFSKCVFCRMDAKNLEAASSLETENWTL
Download sequence
Identical sequences ENSTBEP00000007528 ENSTBEP00000007528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]