SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007593 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007593
Domain Number 1 Region: 62-454
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 1.15e-101
Family 2-methylcitrate dehydratase PrpD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007593   Gene: ENSTBEG00000008764   Transcript: ENSTBET00000008762
Sequence length 480
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_946:29340:37567:1 gene:ENSTBEG00000008764 transcript:ENSTBET00000008762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIY
SSNLSSSVWGQPDFRLPPTYAAFVNGVAIHSMDFDDTWHPATHPSGAVLPVLTALSEAFP
QRPAFSGLDLLLAFNIGVEVQGRLMHFXXXXXXXXXXFHPPSVVGTLGSAAAASKFLGLS
LAKCQEALAIAVSHAGAPMANAATQTKPLHVGNAARHGLEAAFLAMLGLQGNKQVLDMET
GFGAFYANYSPELLPNLDSHTWLLDQQDVAFKRFPAHLATHWVADAAASVRKHLVADRML
LPTDHIRRIVLRIPDVQYVNRPFPDSEHEARHSFQYVACAMLLDGSVTISSFHKHRINRP
QMRELLRKVELEHPLDNQPSFNMLYCEISVTLKDRASFTVRSDTFYGHWRKPLSQKDLEE
KFRANTSGVLSCDTVESLIKVVEKLEDLEDCSVLTTLLKGPSPGQVLQSSPASSSNTNLS
Download sequence
Identical sequences ENSTBEP00000007593 ENSTBEP00000007593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]