SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007649 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007649
Domain Number 1 Region: 276-383
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.75e-33
Family Carbonic anhydrase 0.00011
Further Details:      
 
Domain Number 2 Region: 133-196
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.00000000000178
Family Carbonic anhydrase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007649   Gene: ENSTBEG00000008827   Transcript: ENSTBET00000008828
Sequence length 452
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1173:96164:144863:1 gene:ENSTBEG00000008827 transcript:ENSTBET00000008828 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPSAWLPLLIPDPAGGPTVQLLLLLLLLVPAHPQSLSGMQADSPTEDLSGEDDPLG
KKDLSSEDNSPGEEDPPGEEDPLGEEDLPEDKTDPEEEDSLKPEDLPTVEAPQETQGPQN
NAHRDKKGDDHNHWRYGGDLPWPQVFPACAGRFQSPVDIRPKLATFCPALQPLELLGFQL
PPLPELRLRNNGHTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEGPEDNSAYEPLLSHLEKITEKGSQTW
VPGLDVSALLPSDLSHYFRYEGSLTTPPCAQGVIWTVFNQTVRLSAKQLHTLSDSLWGPG
NSRLQLNFRATQPLNGRIIEASFPVQTESKLRTTEPVHLTSCLAAGDILALVFGLLFAIT
SIAFLVQMRRQHRCGTKGGGSYRPAEVVETGA
Download sequence
Identical sequences ENSTBEP00000007649 ENSTBEP00000007649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]