SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007744 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007744
Domain Number 1 Region: 46-186
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 6.8e-46
Family Molybdopterin synthase subunit MoaE 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007744   Gene: ENSTBEG00000008942   Transcript: ENSTBET00000008934
Sequence length 189
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3332:460744:467509:-1 gene:ENSTBEG00000008942 transcript:ENSTBET00000008934 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEISSSCFNQETKLPLSPLLVEGSTFESLRKEMDEVEEESKDIIKFTAEKLSVDEVS
QLVVSPLCGAISLFVGTTRNNFEGKKVISLEYEAYLPMAENEVRKICSDIREKWPVKHIA
VFHRLGLVPVSEASIIIAVSSAHRAASLEAVSYAIDTLKAKVPIWKKEMYEESSSSWKRN
KECFWATHD
Download sequence
Identical sequences ENSTBEP00000007744 XP_006149085.1.99106 XP_014443488.1.99106 ENSTBEP00000007744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]