SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007757 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007757
Domain Number 1 Region: 4-284
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 5.63e-91
Family Inorganic pyrophosphatase 0.000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007757   Gene: ENSTBEG00000008947   Transcript: ENSTBET00000008948
Sequence length 289
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5475:478870:525511:-1 gene:ENSTBEG00000008947 transcript:ENSTBET00000008948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFSCEERAAPFSLEYRVFLINEKGQYISPFHDIPIYSDKDVFHMVAGVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXMNTTVAESPFKCDPDAAKAIVDALPPPCESACTVPTDVDKWFHNQKN
Download sequence
Identical sequences ENSTBEP00000007757 ENSTBEP00000007757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]