SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007843 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007843
Domain Number 1 Region: 2-198
Classification Level Classification E-value
Superfamily Uracil-DNA glycosylase-like 8.07e-90
Family Uracil-DNA glycosylase 0.00000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007843   Gene: ENSTBEG00000009058   Transcript: ENSTBET00000009051
Sequence length 200
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2432:89310:101507:1 gene:ENSTBEG00000009058 transcript:ENSTBET00000009051 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMGFVAEERKHHTVYPPPDQVFTWTQMCDIRDVKVVILGQDPYHGPNQAHGLCFSVQRPV
PPPPSLENIYKELSTDIDGFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQ
FTDAVVSWLNQNSHGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHF
SKTNELLRKSGKKPINWKEL
Download sequence
Identical sequences ENSTBEP00000007843 ENSTBEP00000007843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]