SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007891 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007891
Domain Number 1 Region: 114-154
Classification Level Classification E-value
Superfamily LysM domain 0.0000034
Family LysM domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007891   Gene: ENSTBEG00000009099   Transcript: ENSTBET00000009106
Sequence length 940
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1378:26215:220639:1 gene:ENSTBEG00000009099 transcript:ENSTBET00000009106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQSKQNAETASALAARTHPGKEDANAAILEQEKCNVAVE
EEYSTDEKKKRKNNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTIEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPXXXXXXXXXXXXXXXXXXXXXXXXDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGERTITLDSKSIGPLEKATEHTDT
KSPSDSVSGKLKAWDSSREATSESPTLTKLSKEPSDTHVAIESTAKENSLLGEDDDFVDL
EELSSQTDGGRDKRDTLKECLSLDPEKKEAESQIIRSAMDMQVPSALNFTETESDAELKR
ALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEELDKVKLIEYYLNKNKEGSQFSENL
QKAELSDGKSSEPVGIDITLSRSLPQAGDLRTEGSEEPDKMQVKQRDPLPLKLSKEENMI
NESLGSSLDSTLDNSCQGAQMDKKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFLCIK
VGKPMRKSFATHTTAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAKEQ
GFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDDEEEVLPILQPHSAL
LENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDNQI
FGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGGRFG
LWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences ENSTBEP00000007891 ENSTBEP00000007891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]