SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007893 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007893
Domain Number 1 Region: 45-133
Classification Level Classification E-value
Superfamily FKBP-like 1.1e-29
Family FKBP immunophilin/proline isomerase 0.00022
Further Details:      
 
Domain Number 2 Region: 112-204
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000196
Family Calbindin D9K 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007893   Gene: ENSTBEG00000009110   Transcript: ENSTBET00000009108
Sequence length 210
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1874:437755:457547:-1 gene:ENSTBEG00000009110 transcript:ENSTBET00000009108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLFLRNTILTLLVTSLSGALIPXXXXXXXXXXXXXXXXXXXXGGDMLVHYEGYLEKDGS
LFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLIIPPALGYGKEGQGNIPP
ESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKVEVKVYLKKEFEKHGAVVNESHHD
ALVEDIFDKEDEDKDGFISAREFTYKHDEL
Download sequence
Identical sequences ENSTBEP00000007893 ENSTBEP00000007893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]