SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000007988 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000007988
Domain Number 1 Region: 663-779
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.69e-21
Family Phosphate binding protein-like 0.000000512
Further Details:      
 
Domain Number 2 Region: 32-339
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.1e-16
Family L-arabinose binding protein-like 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000007988
Domain Number - Region: 616-648
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0589
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000007988   Gene: ENSTBEG00000009199   Transcript: ENSTBET00000009215
Sequence length 1458
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4994:79421:486598:-1 gene:ENSTBEG00000009199 transcript:ENSTBET00000009215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRLGYWTLLVLPALLVWRGPARGAAAEKGPPALNIAVLLGHSHDVTERELRNLWGPEQA
AGLPLDVNVVALLMNRTDPKSLITHVCDLMGARIHGLVFGDDTDQEAAQMLNLISSQTFP
IGHGGASMIXXXXDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFIS
FIKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARS
LGLTGYFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSM
LEKFSYIPEAKASCYGQTEKPEAPLHTLHQFMVNVTWDGXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLT
ETCVRNTVPCRKFVKINNSTNEGMNVKKCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFTIGKAIW
LLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLS
DKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLD
AFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRSAKNISN
MSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGNLIYSDNRSFQGKDSIFGENMNELQTF
VANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKANSRPRQLWKKSMDSIRQDSL
TQNPVSQREEGTVENRTHSLKSPRYLPEEVAHSDISETSSRATCHREPDNNKNHKTKDNF
KRSMASKYPKDCSEVERTYLKTKASSPRDKIYTIDGEKEPGFHLDPPQFVENMALPENVG
FPNAYQDHNENFRKGDSTLPMNRNPLHNEDGLPNNDQYKLYSKHFTLKDKGSPHSEGSER
HRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNPATQEEV
YQQDWAQNNALQFQKNKLRISRQHSYDNILDKPRELDLSRPSRSISLKDRERLLEGNLYG
SLFSVPSSKLSGNKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSYGGDQRLVIGRCPSDP
YKHSLPSQAVNDSYLRSSLRSTASYCSRDGRGHNDVYISEHVMPYAANKNNMYSTPRVLN
SCSNRRVYKKMPSIESDV
Download sequence
Identical sequences ENSTBEP00000007988 ENSTBEP00000007988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]