SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008053 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008053
Domain Number 1 Region: 187-323
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 2.94e-21
Family NadC C-terminal domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000008053
Domain Number - Region: 411-484
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.00286
Family NadC C-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008053   Gene: ENSTBEG00000009297   Transcript: ENSTBET00000009300
Sequence length 491
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_68:280747:322151:-1 gene:ENSTBEG00000009297 transcript:ENSTBET00000009300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAAAEAEFNILLATDSYKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXKVVTKEKIQEAKEVYKEHFQDDVFNEKGWNYILEXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXTILVQSWYPITVATNSREQKKILAKYLLETS
GNLDGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIALIKKYYGTKDPVPGY
SVPAAEHSTITAWGKDHEKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIV
SRSTEAPLIIRPDSGNPLDTVLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINVFKDPVAD
PNKRSKKGRLSLHRTAAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEVRKNA
QLNIELEAAPH
Download sequence
Identical sequences ENSTBEP00000008053 ENSTBEP00000008053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]