SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008162 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008162
Domain Number 1 Region: 1297-1435
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.8e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008162   Gene: ENSTBEG00000009419   Transcript: ENSTBET00000009431
Sequence length 1441
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1680:79467:152535:1 gene:ENSTBEG00000009419 transcript:ENSTBET00000009431 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVPEELREPFYTDQYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQAL
AHKGLYVTDQEKLVTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSAF
FQATDLPYDIEDAVMYWINKVNEHLKDIMEQEQKLKEPPTVEAPGGQKSPSKWFWKLVPA
RYRKEQTLLKQLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSNYLVFMAELFWWFEVVKPSFVQPRVV
RPHGAEPVKDTPSVPVLNAARRNVLASSCSSDFSSSGEGAPFTQSYHRLPSRHSRPQAHS
SASGGIRRSSSMSYVDGFIGTWPKEKRSSVHGVSFDISFDKEDGVQRSTPNRGIIRSISN
EGLTLNNNRVSKHIRKNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSFSVKQRTPRPNELKITPLNRTLTPP
RSVDSLPRLRRFSPSQVPIQTRSFVCFGDDGEPQLKESKPKEEVKKEELESKGTLEQRGQ
NLEENIKLFESTVSEVLSHPVTETVCLTPNEDQLNQPTEPPPKPIFPPAAPKNVNLIEVS
LSDLKPPEKTDVAVEKSEGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRL
RREKETQLRKQQLEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMED
MDTVIKPRPQVVKQKKQRPKSIHRDHIESPKTPIKGPPVSSLSLASLNTGDNESIHSGKR
TPRSGVSGFLSPSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNA
LAHCCLAGKVNEGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGI
GPKSITKKMIEGLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQSKRPVTPKKLLPTR
A
Download sequence
Identical sequences ENSTBEP00000008162 ENSTBEP00000008162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]