SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008282 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008282
Domain Number 1 Region: 50-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 7.98e-58
Family Carbonic anhydrase 0.000000332
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008282   Gene: ENSTBEG00000009567   Transcript: ENSTBET00000009566
Sequence length 258
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4265:9590:29635:1 gene:ENSTBEG00000009567 transcript:ENSTBET00000009566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLNSLRAILQASSCRWLWRSFQIPRSTPVRRCSLYTCTYKTRNRTLHPLWERVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPTTCLHIWNNGYSFLVEFEDSADKSVIEGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAEXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQ
Download sequence
Identical sequences ENSTBEP00000008282 ENSTBEP00000008282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]