SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008339 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000008339
Domain Number - Region: 3-60
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000981
Family VPS37 C-terminal domain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008339   Gene: ENSTBEG00000009636   Transcript: ENSTBET00000009636
Sequence length 140
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_14022:3:963:-1 gene:ENSTBEG00000009636 transcript:ENSTBET00000009636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRWSPHCALGWLQAELEEAEQEAEEQMEQLLLGEQSLEAFLPAFQRGRALAHLRRTQAE
KLQELLRRRERSAQPAPTAAAAADPPKPFPAAAVLPTGAARGPPAVPRSLPPLDSRPVPP
LKGPRWPLGPAPLLSPRPSQ
Download sequence
Identical sequences ENSTBEP00000008339 ENSTBEP00000008339

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]