SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008549 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008549
Domain Number 1 Region: 278-482
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-65
Family ALDH-like 0.00000556
Further Details:      
 
Domain Number 2 Region: 7-90
Classification Level Classification E-value
Superfamily ALDH-like 1.2e-16
Family ALDH-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008549   Gene: ENSTBEG00000009872   Transcript: ENSTBET00000009868
Sequence length 483
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1699:239916:269263:-1 gene:ENSTBEG00000009872 transcript:ENSTBET00000009868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARTQELLILENFIDGKFLPCHSYIDSYDPSTGEVYCRVPNSGKEEIEAAVQAARAAFVS
SAPQERSRVLNKLADLLEQSLEEFAQAESKQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGEICLCTSRIFVQKSIYSEFL
KRFVEATREWKVGIPSDPSASMGALISNTHLEKVRSYIKKARAEGAQILCGEGVDTLDLP
PKNRAGYFMLPTVITNITDESCCMKEEIFGPVTCVVPFDNEEEVIKRANNVKYGLAATVW
SSNVGRIHRVAKGLQSGLVWTNCWLIRELNLPFGGMKSSGIGREGAKDSYEFFTEIKTIT
VKH
Download sequence
Identical sequences ENSTBEP00000008549 ENSTBEP00000008549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]