SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008736 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008736
Domain Number 1 Region: 45-236
Classification Level Classification E-value
Superfamily Cytochrome c 4.73e-74
Family Cytochrome bc1 domain 0.00000000648
Further Details:      
 
Domain Number 2 Region: 237-282
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 3.66e-16
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.0000971
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008736   Gene: ENSTBEG00000010106   Transcript: ENSTBET00000010096
Sequence length 282
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_68321:3116:4502:1 gene:ENSTBEG00000010106 transcript:ENSTBET00000010096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVALSSKSGPSRGRKVMLSALGVLAAGGAGLAVALHSAVSASDLELHPPSYPWTHRGLLS
SLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEEEAKALAEEVEVQDGPNEDGE
MFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPT
GVSLREGLYFNPYFPGQSIGMAPPIYTDVLEFDDGTPATMSQVAKDVCTFLRWASEPEHD
HRKRMGLKMLLMMGLLLPLIYAMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences ENSTBEP00000008736 ENSTBEP00000008736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]