SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008836 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008836
Domain Number 1 Region: 465-755
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.66e-76
Family Protein kinases, catalytic subunit 0.000000271
Further Details:      
 
Domain Number 2 Region: 309-392
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-34
Family Kringle modules 0.00035
Further Details:      
 
Domain Number 3 Region: 60-152
Classification Level Classification E-value
Superfamily Immunoglobulin 8.83e-22
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000008836
Domain Number - Region: 168-255
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.00366
Family Frizzled cysteine-rich domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008836   Gene: ENSTBEG00000010209   Transcript: ENSTBET00000010216
Sequence length 935
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2922:54877:481353:1 gene:ENSTBEG00000010209 transcript:ENSTBET00000010216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRARRLGRPALRELLALLLAARGAAAQETELSVTAELVPTSSWNISSELDKDSYLTLDE
PMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRISFRATSYGSRLRIRNLD
TTDTGYFQCVATNGKKVVSTTGVLFVKFGPPPTASPGSSDEYEEDGFCQPYRGIACARFI
GNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSPAP
KPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIP
MADPINKNHKCYNNTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYC
RNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEILYILVPSVAIPLAIALLF
FFICVCRNNQKSSSPPVQRQPKHVRGQNVEMSMLNAYKPKSKAKELPLSAVRFMEELGEC
AFGKIYKGHLYLPGMDHAQLVAIKTLKDYNNPQQWTEFQQEASLMAELHHPNIVCLLGAV
TQEQPVCMLFEYMNQGDLHEFLIMRSPHSDVGCSSDEDGTVKSSLDHGDFLHIAIQIAAG
MDYLSSHFFVHKDLAARNILIGEQLHVKISDLGLSREIYSADYYRVQSKSLLPIRWMPPE
AIMYGKFSSDSDIWSFGVVLWEIFSFGLQPYYGFSNQEVIEMVRKRQLLPCSEDCPPRMY
NLMTECWNEIPSRRPRFKDIHVRLRSWEGLSSHTSSTTPSGGNATTQTTSLSASPVSNLS
NPRYPNYMFPSQGIPPQGQIAGFIGPPIPQNQRFIPINGYPIPPGYAAFPAAHYQPAGPP
RVIQHCPPPKSRSPSSASGSTSTGHVTSLPSSGSNQEANIPLLPHMSIPNHPGGVGITVF
GNKSQKPYKIDSKQPSLLGDSNIHGHTESMISAEL
Download sequence
Identical sequences ENSTBEP00000008836 ENSTBEP00000008836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]