SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008852 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008852
Domain Number 1 Region: 514-633
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 3.79e-42
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000241
Further Details:      
 
Domain Number 2 Region: 62-194
Classification Level Classification E-value
Superfamily Radical SAM enzymes 4.45e-40
Family MoCo biosynthesis proteins 0.0000955
Further Details:      
 
Domain Number 3 Region: 253-327
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000334
Family MoCo biosynthesis proteins 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008852   Gene: ENSTBEG00000010227   Transcript: ENSTBET00000010233
Sequence length 636
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3051:85337:118567:-1 gene:ENSTBEG00000010227 transcript:ENSTBET00000010233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARSVSRMLRRLLRSSSRSCSSGAPVTQPRPGEPSQPAAEALSRRRQFLQEHTAPFSAF
LTDSFGRQHSYLRISLTEKCNLRCQYCMPEEGVPLTPKADLLTTEEILTLARLFVKEGVD
KIRLTGGEPLIRPDVVDIVARLNQLEGLRTIGVTTNGINLARLLPQLQKAGLSAVNISLD
TLVPAKFEFIVRRKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXNKWNFKKMVSYKEMLDTIQQQWPELEKVPEEESSTAKAFKIPGFQGQ
VSFITSMSEHFCGTCNRLRITADGNLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGPVAFKLVQQNQLKKGDALGVAQLAG
VQAAKLTSQLIPLCHHVALSHVQVRLELDSTHHAVVIEASCRARGPTGVEMEALTSAAVA
ALTLYDMCKAVSRDIVLGEIKLISKTGGQRGDFHRA
Download sequence
Identical sequences ENSTBEP00000008852 ENSTBEP00000008852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]