SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000008923 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000008923
Domain Number 1 Region: 5-415
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 4.36e-166
Family Phosphoglycerate kinase 0.000000000000346
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000008923   Gene: ENSTBEG00000010309   Transcript: ENSTBET00000010318
Sequence length 416
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_148407:40776:67361:1 gene:ENSTBEG00000010309 transcript:ENSTBET00000010318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACADPPAGSVILLE
NLRFHVEEEGKGKDSSGNKVKAEPAKIEAFRASLSKLGDIYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMKKELNYFAKALESPERPFLAILGGAKVADKIQLINNMLDKVNEMIIGGGM
AFTFLKVLNNMEIGTSLFDEEGAKIVKDLMTKAEKNGVKITLPVDFVTADKFDENAKTGQ
ATVASGIPAGWMGDCGPESSKKYAEAVGRAKQIVWNGPVGVFEWEAFARGTKALMDEVVK
ATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNV
Download sequence
Identical sequences ENSTBEP00000008923 ENSTBEP00000008923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]