SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009035 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009035
Domain Number 1 Region: 9-401
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 7.06e-111
Family Homocysteine S-methyltransferase 0.0000103
Further Details:      
 
Domain Number 2 Region: 358-494
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 3.01e-43
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.0022
Further Details:      
 
Domain Number 3 Region: 1065-1177
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 1.83e-41
Family Methionine synthase SAM-binding domain 0.0000548
Further Details:      
 
Domain Number 4 Region: 554-632
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 4.71e-18
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.023
Further Details:      
 
Domain Number 5 Region: 669-719
Classification Level Classification E-value
Superfamily Methionine synthase domain 0.0000000000589
Family Methionine synthase domain 0.0004
Further Details:      
 
Domain Number 6 Region: 759-789
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 0.0000000111
Family Cobalamin (vitamin B12)-binding domain 0.0011
Further Details:      
 
Domain Number 7 Region: 940-980
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.0000000146
Family Methionine synthase SAM-binding domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009035
Domain Number - Region: 1226-1253
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 0.00149
Family Methionine synthase SAM-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009035   Gene: ENSTBEG00000010404   Transcript: ENSTBET00000010448
Sequence length 1254
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_636:204594:272875:1 gene:ENSTBEG00000010404 transcript:ENSTBET00000010448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMKQTLHDEIEAILQKRVMVLDGGMGTMIQRYRLEEDDFRGQEFRGHARPLKGNNDILSI
TRPDVIRQIHKEYLLAGADIIETNTFSSTSIAQADYGLEHLVYRMNKCSADLAREAAAEV
TQQTGVKRFVAGALGPTNKTLSVSPSVERPDYRNITFDELVEAYREQAMGLLDGGVEILL
VETIFDTANAKAALFALQELFEEKYTPRPIFVSGTIVDKSGRTLSGQTGEAFVISVSHAD
PLCIGLNCALGATEMRPFIETIGKCTTAYVLCYPNAGLPNTFDYDETPAIMARHLKDFAV
DGLVNVVGGCCGSTPDHIREIAEAVKSCRPRVPPAAVFEGHMLLSGLEPFRMGPYTNFVN
IGERCNVAGSRKFAKLVMAGSYEEALSVARVQVEMGAQVLDINMDDGLLDGPRAVARFCN
LIASEPDIAKVPLCIDSSNFAVIEAGLKCCQGKCIVNSISLKEGEGDFLEKARRVKRFGA
AVVVMAFDEEGQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXETLPGARISGGLSNLSFSFRGMEAIREAMHGVFLYHAIKFGMDMGIVN
AGNLPVYDDIHKELLQLCEDLIWNRDPEATEKLLRYAQXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXGIEKHIIEDTEEARVNQRKYPRPLSIIEGPLMNGMRIVGDLFGAGKMFLPQX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPYQGTVVLATVKGDVHDIGKNI
VGVVLGCNNFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKPTFLGTRVFEDYDLHKLVD
YIDWKPFFDVWQLRGKYPNRGFPKIFNDKTVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXASSEPYHCLADFVAPLHS
GVRDYLGLFAVACFGVEELSRAYEDSGDDFSSIMVKALGDRLAEAFAEELHERVRRELWA
YGGSEQLSVADLRRLRFQGIRPAPGYPSQPDHTEKLTXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVEDYASRKGMPVAQVEKWLGPVLGYDTD
Download sequence
Identical sequences ENSTBEP00000009035 ENSTBEP00000009035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]