SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009042 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009042
Domain Number 1 Region: 550-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.33e-41
Family YicI catalytic domain-like 0.0034
Further Details:      
 
Domain Number 2 Region: 343-475
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.21e-26
Family YicI catalytic domain-like 0.0026
Further Details:      
 
Domain Number 3 Region: 66-161,211-341
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0000000000027
Family YicI N-terminal domain-like 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009042
Domain Number - Region: 720-775
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0115
Family Putative glucosidase YicI, domain 3 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009042   Gene: ENSTBEG00000010421   Transcript: ENSTBET00000010458
Sequence length 914
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_722:11795:161104:1 gene:ENSTBEG00000010421 transcript:ENSTBET00000010458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAEKEEISVEDEAVDRNIFRDCSKIAFYRRQKQLLSKNSTYRALLDSVTIGKDSTQFQ
ITNEARKVPLLAEVYGIEGNIFRLKINEETPLKPRYEVPDVLTSKPNSVRLISCSGDTSN
LVLADEKGELKCHIMANPFKVDLVSKEEVVLSINAQGQLYFEHLQIPLKQRAAKENEKSA
SSPTSQETQEDLGLWEEKLGKFVDVKANGPTSIGLDFSLHGFEHVYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEIHTEPAV
EYTLTQLSPVAAKQKVKSRTDVRWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDTHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQELLRSKKRKLVVISDPHIKVDPDYSVYAKAKKKGFFVKNPEGGDFEGVCWPGLSCYXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXQMATAEGLIKRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSYLKISIP
MLLTLSITGISFCGADVGGFIGNPEAELLVRWYQAGAYQPFFRGHAAMKTKRREPWLFGE
ENTRLIREAIRERYTLLPFWYFLFYRTHVASEPVMXXXXXXXXXXXXXXXXXXXXXXXSA
LLLRPVTXXXXXXXXXXXXXXXXVWYDSKTFTRWEGGCTVKVPVSLDTIPVFQRGGSVVP
IKTTIGKSTGWMTNCPYGLRVALSTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXCADERGHYSSQCVVEQILVLGLRKEPSSVTAHLSDGKDQPVAFTYCAKTSALTLEK
LSLDVGADWEVHIK
Download sequence
Identical sequences ENSTBEP00000009042 ENSTBEP00000009042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]