SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009088 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009088
Domain Number 1 Region: 4-108
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.27e-22
Family Isochorismatase-like hydrolases 0.00041
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009088
Domain Number - Region: 147-188
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.000345
Family Isochorismatase-like hydrolases 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009088   Gene: ENSTBEG00000010521   Transcript: ENSTBET00000010509
Sequence length 195
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1459:220780:228883:1 gene:ENSTBEG00000010521 transcript:ENSTBET00000010509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTTLGNLTPSSTVFFCCDMQERFRPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKG
LGSTVQEIDLTGVKLVLPKTKFSMVLPEVEAALAEIPGVRSVVLFGVEXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXRLARIGIIVTTSEAVLLQLVSDKDNPKVKEIQN
LIKASAPESGLLSKV
Download sequence
Identical sequences ENSTBEP00000009088 ENSTBEP00000009088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]