SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009225 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009225
Domain Number 1 Region: 4-187
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 6.28e-39
Family D-ribulose-5-phosphate 3-epimerase 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009225   Gene: ENSTBEG00000010676   Transcript: ENSTBET00000010665
Sequence length 195
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_3485:232658:233336:-1 gene:ENSTBEG00000010676 transcript:ENSTBET00000010665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASDCKIGPSILNSELASLGAERLQMLDSGADYLHLDVMDGQFVPNITFGHPVVESLKQQD
QDPFSDIHMTMYRPEQWIKPMAVARANQYTFHLEATENPGAWIKDIQENGMKVGLAIKPG
TTAENLAPWANQTDMALVMMVELGFGRKFIEDMMPKAGANMIVSGGAFMRSEDPRSVINL
LRNVCSEAAQKPSLD
Download sequence
Identical sequences ENSTBEP00000009225 ENSTBEP00000009225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]