SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009237 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009237
Domain Number 1 Region: 194-274
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 3.4e-28
Family eIF-2-alpha, C-terminal domain 0.00000792
Further Details:      
 
Domain Number 2 Region: 90-158
Classification Level Classification E-value
Superfamily eIF2alpha middle domain-like 1.44e-24
Family eIF2alpha middle domain-like 0.0000121
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009237   Gene: ENSTBEG00000010682   Transcript: ENSTBET00000010681
Sequence length 274
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_445:156324:182150:1 gene:ENSTBEG00000010682 transcript:ENSTBET00000010681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXRTERERRYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEVLE
YTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXIEVACYGYEGIDAVKEALRAGLNCSTETMPIKINLIAPPRYVMTTT
TLERTEGLSVLNQAMAVIKEKIEEKRGVFNVQME
Download sequence
Identical sequences ENSTBEP00000009237 ENSTBEP00000009237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]