SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009286 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009286
Domain Number 1 Region: 23-183
Classification Level Classification E-value
Superfamily PHP domain-like 3.88e-39
Family RNase P subunit p30 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009286   Gene: ENSTBEG00000010734   Transcript: ENSTBET00000010740
Sequence length 222
Comment pep:known_by_projection scaffold:TREESHREW:scaffold_133334:189386:209258:1 gene:ENSTBEG00000010734 transcript:ENSTBET00000010740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EIEKPVAVSELFTTLPIVQGKSRPIKILTRLTIIVSDPSHCNVLRATSSRVRLYDIVAIF
PKTEKLFHVACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGLGFELVYSPAIKDSTMR
RYTISNALNLMQVCKGKNIIISSAAEKPLEIRGPYDVANLGLLFGLSESDAKAAVCTNCR
AAILQGETRKTAFGIISTVKKPRPSEGDDESLPACKKAKCES
Download sequence
Identical sequences ENSTBEP00000009286 ENSTBEP00000009286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]