SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009304 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000009304
Domain Number - Region: 85-120
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00621
Family VPS37 C-terminal domain-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009304   Gene: ENSTBEG00000010775   Transcript: ENSTBET00000010760
Sequence length 248
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2737:721:2361:-1 gene:ENSTBEG00000010775 transcript:ENSTBET00000010760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQNVQLNKEMTLASNRSLAEGNLLYQPRLDALKARLTQRYQELQALFEAYQIKKTQLXXX
XXXXXXXXXXXXXXXXXXXXXXXXXNMAEKFLDGELPLDSFIDTYQSQRKLAHTRRVKIE
KLQEMVLKGQRLPQAPAPLPSRAPEAAPTAAAPYPAPKASGPPSVVPRRIPPPPPPVPAG
RLATPFTAAMGSGQAAPYPGLQCPPLPPRVGLPVQQGFAAPFVSPYPPALPQRPPPRLPP
HQPGFILQ
Download sequence
Identical sequences ENSTBEP00000009304 ENSTBEP00000009304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]