SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009359 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009359
Domain Number 1 Region: 386-555
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.11e-42
Family Eukaryotic proteases 0.0003
Further Details:      
 
Domain Number 2 Region: 256-364
Classification Level Classification E-value
Superfamily Kringle-like 2.22e-32
Family Kringle modules 0.00027
Further Details:      
 
Domain Number 3 Region: 152-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000181
Family EGF-type module 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000009359
Domain Number - Region: 190-230
Classification Level Classification E-value
Superfamily FnI-like domain 0.00146
Family Fibronectin type I module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009359   Gene: ENSTBEG00000010801   Transcript: ENSTBET00000010821
Sequence length 561
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3606:179978:186590:1 gene:ENSTBEG00000010801 transcript:ENSTBET00000010821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRWAWVPSPYPPTRLSLLLLLLLPHVTQPQASVNHTSELRTAPATSXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXALDPCASNPCLNGGTCSNTQDPVSYHCTCP
MAFMGKDCGTEKCFDETRSEYLEVGDRWARVHQGRVEQCSCTEGQARCEDTRHTACLSSP
CLNGGTCHLIVATGTTVCACPPGYTGRLCNIVPAESCFLGNGTQYRGVASTAASGLHCLP
WNSDLLYQELHVDSVGAAALLGLGPHAYCRNPDKDEKPWCYVVKDNALSWEYCRLAACES
FARIQPLAPEVLATLPEPAPTGRQTCGKRHKKRTFLRPRIIGGSSSLPGSHPWLAAIYIG
NSFCTGSLIHTCWVVSAAHCFSNSPRRENVLVVLGQHFFNRTTDVTQTFGIEKYIPYPLY
SVFNPSDHDLVLIRLKKKGDRCAVRSQFVQPICLPESGSTFSVGHKCQIAGWGHTDENLS
GYSSSVREELVPIVAEHESNS
Download sequence
Identical sequences ENSTBEP00000009359 ENSTBEP00000009359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]