SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009553 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009553
Domain Number 1 Region: 274-336
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00000000000000109
Family RILP dimerisation region 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009553   Gene: ENSTBEG00000011046   Transcript: ENSTBET00000011053
Sequence length 336
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5284:8070:87368:-1 gene:ENSTBEG00000011046 transcript:ENSTBET00000011053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAELVMNVYDIASLVDHEERVIDQHGCEAIARMPKVVRVLEILEVLVSRHHVAPELDELR
LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKD
TSFSEEEFQKHEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXVEPGGEECISDVEKAAMDLKDPNRPRFTLQELRDVLQERNELKARVFLLQEELA
YYKRCGDEMEEENRILQPPPVVHPRTAPQPESGIKR
Download sequence
Identical sequences ENSTBEP00000009553 ENSTBEP00000009553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]