SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009601 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009601
Domain Number 1 Region: 33-550
Classification Level Classification E-value
Superfamily Aconitase iron-sulfur domain 7.59e-165
Family Aconitase iron-sulfur domain 0.00000000000000306
Further Details:      
 
Domain Number 2 Region: 557-776
Classification Level Classification E-value
Superfamily LeuD/IlvD-like 6.67e-65
Family LeuD-like 0.00000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009601   Gene: ENSTBEG00000011060   Transcript: ENSTBET00000011110
Sequence length 780
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_4122:174796:229998:1 gene:ENSTBEG00000011060 transcript:ENSTBET00000011110 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPYSLLVTRLQKALGVRRYHVASVLCQRAKVAMSHFEPNEYIRYDLLEKNINIVRKRLN
RLLTLSGKIGYGHLDDPAGQEDKRGKTYLRLRPDRVAMQDATAKMAMLQFISSGLPRVAV
PSTIHCDHLIEAQLGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILEN
YAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSG
WTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN
HRMKKYLSKTGRADIANLADEFKDHLVPDPGCHYDQLIEINLSELKPHINGPFTPDLAHP
VAEVGSVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAVARQALAHGLKCKSQFTITPGS
EQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRKDIKKGEKNTIVTSYNRNFTGRN
DANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGKDGKKFKLEAPDADELPRAEFDPG
QDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDGKDLEDLQILIKVKGKCTTDHISAA
GPWLKFRGHLDNISNNLLIGAINIENGKANSVRNAVTQEFGPVPDTARYYKKHGIRWVVI
GDENYGEGSSREHAALEPRHLGGRAIITKSFARIHETNLKKQGLLPLTFADPADYNKIHP
VDKLTIQGLKDFAPGKPLKCIIKHPNGTQETILLNHTFNETQIEWFRAGSALNRMKELQQ
Download sequence
Identical sequences ENSTBEP00000009601 ENSTBEP00000009601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]