SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009605 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009605
Domain Number 1 Region: 119-175
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009605   Gene: ENSTBEG00000011105   Transcript: ENSTBET00000011116
Sequence length 456
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_316:11398:38511:1 gene:ENSTBEG00000011105 transcript:ENSTBET00000011116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPPGECTYAGRKRRKPVQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLN
GFALVVSAEGVIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCQQLHWAMDPPQV
VFGQPLHPETXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXTMQFQGKLKFLLGQQKKAPSGTALPPRLSLFCVVVPVLLPSVAEMK
MKSVFLRAKHRADPVATMDTKVKAPPRPCVPELPRKRAHVAGRSNGEACVPVFRAQMDAV
RCPRVLTQAPCLCLRGGPDLAPQGAARHGEEEEPECVLSGSCGLTGWGETPGPSRRPTLV
SEERSQEAIRLQLHSSSSGLFSLCCPHPGIQSTFRG
Download sequence
Identical sequences ENSTBEP00000009605 ENSTBEP00000009605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]