SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009908 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009908
Domain Number 1 Region: 2-129
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.31e-29
Family N-terminal domain of MutM-like DNA repair proteins 0.000000441
Further Details:      
 
Domain Number 2 Region: 133-239
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.86e-25
Family Middle domain of MutM-like DNA repair proteins 0.00000298
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009908   Gene: ENSTBEG00000011471   Transcript: ENSTBET00000011470
Sequence length 389
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2770:105:4126:1 gene:ENSTBEG00000011471 transcript:ENSTBET00000011470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASRFVNDACGQLLFGGAVEKSAVSRNPEVPFESSAYRISAAARGKELRLTL
SPLPGARPPQPPRALVFRFGMSGSFQLAPADELPRHAHLRFYTAPPGPRLALCFVDIRRF
GRWDLGGEWGPDRGPCVLGEYERFRDNVLRNLADKAFDRPICETLLDQRFFNGIGNYLRA
EILYRLKIPPFEKARTVLEALQQRKPSPELTLSQKIRNKLQNPDLLELCHSVPKEVVQLX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKSRRKKP
KAAPPGPERTEDPPPPSKAPSRTRRAQRSLPEKSTTQQPKGTHLQQDPQAPPEPGKGRRK
GQRAASGRPRPRRMKPDTLSSEPDGTSAS
Download sequence
Identical sequences ENSTBEP00000009908 ENSTBEP00000009908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]