SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000009989 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000009989
Domain Number 1 Region: 598-703
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.28e-23
Family Phosphate binding protein-like 0.0000225
Further Details:      
 
Domain Number 2 Region: 332-409
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.0000000000000106
Family Phosphate binding protein-like 0.0000909
Further Details:      
 
Domain Number 3 Region: 219-310
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.00000000000111
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000009989   Gene: ENSTBEG00000011541   Transcript: ENSTBET00000011561
Sequence length 756
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_1109:295:24952:-1 gene:ENSTBEG00000011541 transcript:ENSTBET00000011561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQILPKGVVSVLGPSSSPASASTVSHICGEKEAHHIKVGPEETXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXRSPNMSWRENCEASTYPGPALSAALMFDAVHVVVSAVRELN
RSQEIGVKPLACTSANIWPHGTSLMNYLRMVEYDGLTGRVEFNSKGQRTNYTLRVLEKSR
QGHREIGVWYSNRTLAMNATTLDINLSQTLANKTLVVTTILENPYVMRRPNFQALSGNER
FEGFCVDMLRELAELLRFRYRLRLVEDGLYGAPEPNGSWTGMVGELINRXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXWAFTLIIISSYTANLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSR
YQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQIGGL
LDTKGYGIGMPLGSPFRDEITLAILQLQENNRLEILKRKWWEGGRCPKEEDHRAKGLGME
NIGGIFVVLICGLIIAVFVAVMEFIWSTRRSAESEE
Download sequence
Identical sequences ENSTBEP00000009989 ENSTBEP00000009989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]