SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010068 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010068
Domain Number 1 Region: 1490-1654
Classification Level Classification E-value
Superfamily Fibronectin type III 4.12e-27
Family Fibronectin type III 0.0000568
Further Details:      
 
Domain Number 2 Region: 1846-2013
Classification Level Classification E-value
Superfamily Fibronectin type III 6.15e-27
Family Fibronectin type III 0.00000894
Further Details:      
 
Domain Number 3 Region: 858-1026
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-25
Family Fibronectin type III 0.00058
Further Details:      
 
Domain Number 4 Region: 406-461
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-21
Family Fibronectin type II module 0.0000509
Further Details:      
 
Domain Number 5 Region: 1665-1834
Classification Level Classification E-value
Superfamily Fibronectin type III 1.43e-20
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 346-401
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-20
Family Fibronectin type II module 0.0000586
Further Details:      
 
Domain Number 7 Region: 1398-1487
Classification Level Classification E-value
Superfamily Fibronectin type III 9.74e-19
Family Fibronectin type III 0.00000591
Further Details:      
 
Domain Number 8 Region: 1219-1306
Classification Level Classification E-value
Superfamily Fibronectin type III 6.91e-16
Family Fibronectin type III 0.00000375
Further Details:      
 
Domain Number 9 Region: 2249-2291
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000111
Family Fibronectin type I module 0.0018
Further Details:      
 
Domain Number 10 Region: 93-138
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000262
Family Fibronectin type I module 0.00012
Further Details:      
 
Domain Number 11 Region: 2204-2247
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000767
Family Fibronectin type I module 0.0034
Further Details:      
 
Domain Number 12 Region: 230-272
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000000772
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 13 Region: 49-90
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000236
Family Fibronectin type I module 0.00017
Further Details:      
 
Domain Number 14 Region: 141-181
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000034
Family Fibronectin type I module 0.00018
Further Details:      
 
Domain Number 15 Region: 184-227
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000359
Family Fibronectin type I module 0.00013
Further Details:      
 
Domain Number 16 Region: 304-342
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000115
Family Fibronectin type I module 0.0003
Further Details:      
 
Domain Number 17 Region: 557-600
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000144
Family Fibronectin type I module 0.002
Further Details:      
 
Domain Number 18 Region: 2106-2181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000389
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 19 Region: 1042-1130
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000336
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 20 Region: 715-786
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000132
Family Fibronectin type III 0.0083
Further Details:      
 
Domain Number 21 Region: 645-702
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000201
Family Fibronectin type III 0.0000452
Further Details:      
 
Weak hits

Sequence:  ENSTBEP00000010068
Domain Number - Region: 1367-1411
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00158
Family Fibronectin type III 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010068   Gene: ENSTBEG00000011563   Transcript: ENSTBET00000011649
Sequence length 2386
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_2660:38465:129444:-1 gene:ENSTBEG00000011563 transcript:ENSTBET00000011649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGPGPGPLLLAVLCLGTAVHSTGASKSKRQAQQIVQPQSPVAVSQSKPGCYDNGKHYQ
INQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTGNTYRVGDTYERPKDSMI
WDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCK
PIAEKCFDHGAGTSYVVGETWEKPYQGWMMVDCTCLGEGNGRITCTSRNRCNDQDTKRSY
RIGETWTKKDNRGNLLQCVCTGNGRGEWKCERSLQTTSTGSGSITDVRTAIYQPQPHPQP
VPYGHCVTDSGVVYSVGMQWLKTQGNKQMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVL
PFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHF
PFLYNNHNYTDCTSEGRRDNMKWCGTTPNYDADQKFGFCPMAXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXQCQDSETRTFYQIGDSWKYVHGVRYQCYCYGRGIGEWHCQPLQ
TYPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNSLGGWKEATIPGHL
NSYTIKGLKPGVIYEGQLISIQQYGHREVTRFDFTTTSTSAPVTSNNMTGERVLLHPLPS
TATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDAPPDPAVDQVDDTSIVVR
WSRPQAPITXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRNQEST
PCFIQQETTGVPRPDKVPPPKDLQFVEVTDVKVTIMWTPPESSVTGYRVDVIPVHLPGEH
GQRLPISRNTFAEITGLSPGVTYYFKVFAVNNGRESKPLTAQQTTKLDAPTNLQFFNETD
SSVMVTWTPPRAQIAGYRLSIGLTRGGQPKQYNVGPSATKYPVRNLQPGSEYTVTLVAVK
GNQQSPKATGVFTTLQPGSSIPPYNTEVTETTIVITWTPAPRIGFKLGVRPSQGGEAPRE
VTSESGSIVVSGLTPGVEYVYTIQVLKDGQERDAPIVNRVVTPLSPPTNLHLEANPDTGV
LKVSWEKSTTPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXVPQLTDLSFVDITDSSIGLRWTPLNSSTIIGYRITVVAAGEGIP
IFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAPTTLTQQTXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLLPGTEYLVSVS
SVYEQHESTPLKGRQKTGLDSPSGMDFSDIMPNSFTVHWVAPRAPITGYKIRHHPEHVSG
RPREDRVPPSRNSITLTNLNPGTEYVVSIIALNGREESPALIGQQSTVSDVPRDLEVIAS
TPTSVLISWDAPAVTVRYYRITYGETGGSSPVQDFTVPGSKSTATITGLKPGVDYTITVY
AVTGRGDSPASSKPVSIDYRTEIDKPSQMQVTDVQDNSISVRWLPSSSPVTGYRVTTTPK
NGPDETEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIK
IAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDM
ESQPLIGTQSTAIPAPTNLKFTQVTPTSLTAQWTPPSVQLTGYRVRVTPKEKTGPMKEIN
LAPDSSSVVVSGLMVATKYEVSIYALKDTLTSRPAQGVATTLENVSPPRRARVTDATETT
ITISWRTKTETITGFQVDAVPANGQTPIQRTIKPDVRSYTITGLQPGTDYKIYLYTLNDN
ARSSPVIIDASTAIDAPSNLRFLATTPNSLLVSWQPPRAKITGYIIKYEKPGSPSREVVP
RPRPGITEATITGLEPGTEYRIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPE
ILDVPSTVQKTPFITNPEYDTGNGIQLPGTSGQQPSVGQQMIFEEHGFRRTTPPTTATPI
RHRPRPYPPNVGQEALSQTTISWTPFQESSEYIISCHPVGTDEEPLQFRVPGTSTSATLT
GLNRGATYNIIVEALKDQTRHKVREEVVTVGNSVNEGLNQPTDDSCFDPYTVSHYAIGEE
WERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTCVG
NGKGEFKCDPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGWRCDNCRRPGAEP
SPEGSTGHSYNQYSQRYHQRTNTNVNCPIECFLPLDVQADRDDSRE
Download sequence
Identical sequences ENSTBEP00000010068 ENSTBEP00000010068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]