SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010098 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010098
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 9.02e-22
Family LEM domain 0.0000623
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010098   Gene: ENSTBEG00000011683   Transcript: ENSTBET00000011681
Sequence length 691
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1810:93126:107569:1 gene:ENSTBEG00000011683 transcript:ENSTBET00000011681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTPRNRPPLAAGANSK
GPPDFSSDEEREPTPVLGAGAAAAGRSRAAVGRXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCLEKSSSSQPELAT
MLVASAPSPSLIKETTTTCYKDMVENIYCGEKSGIQPLRTEQSHVSDQSILSSKRKVLEE
SERSQVISPPLAQAIRDYVNSLLVQSGVGGLPGTSNSVPPLDVENIWKRIDPSDFHKTES
LSPPRKFPRLSEKSVEEGDSGSSVAFQSIPASEVMSSFAKTVVLHSLTTLGIEMSKDSQH
NRIGTSELSFPFHESILKVIEEEWQQIDRQLPSLACKYPISSKEATRILSVPKVDDEIQG
FISETLPAGIQAASTECDKQLNLALCRSYEAAASALQIATHMAFVAKAMQADISQAAQIL
SSDPSRMHQALGTLSKTYDAASFLCEAAFDEVKMAAHSMGSSTLGLRYLSLKECKINPAL
KTKLAVTPFRGGTLFGGEVCKVVKKRGNKHK
Download sequence
Identical sequences ENSTBEP00000010098 ENSTBEP00000010098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]