SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010160 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000010160
Domain Number - Region: 34-64
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0484
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010160   Gene: ENSTBEG00000011746   Transcript: ENSTBET00000011748
Sequence length 202
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3061:237192:363129:1 gene:ENSTBEG00000011746 transcript:ENSTBET00000011748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAQARXXXXXXXXXXXXXXXXXXXXXXXXXXXEEDELKAELVQLEDEITTLRQVLSAKE
RHLVEIKQKLGMNLMNELKQNFSKSWHDMQTTTAXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXYSIRHSISMPAMRNSPTFKSFEERVETTVTSLKTKVGGTNHSGGSFEEVLNS
TAHASAQSSAGGPRRAEEELQC
Download sequence
Identical sequences ENSTBEP00000010160 ENSTBEP00000010160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]