SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010220 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010220
Domain Number 1 Region: 200-346
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 2.49e-39
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00036
Further Details:      
 
Domain Number 2 Region: 40-105
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 1.65e-32
Family Hedgehog (development protein), N-terminal signaling domain 0.0000353
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010220   Gene: ENSTBEG00000011825   Transcript: ENSTBET00000011814
Sequence length 408
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3782:158419:163488:-1 gene:ENSTBEG00000011825 transcript:ENSTBET00000011814 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPARLRPLRFCLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGA
SGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTFSDV
LIFLDREPDRLRAFQVIETQDPPRRLDLTPAHLLFTADNHTEPVAHFRATFASHVQPGQY
VLVAGAPGLQPARVAAVSTHVALGAYAPLTRHGTLVMEDVVASCFAAVADHHLAQLAFWP
LRLFHSLAWGSWTPGEGIHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
Download sequence
Identical sequences ENSTBEP00000010220 ENSTBEP00000010220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]