SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010270 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTBEP00000010270
Domain Number - Region: 29-122
Classification Level Classification E-value
Superfamily TrmE connector domain 0.0366
Family TrmE connector domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010270   Gene: ENSTBEG00000011867   Transcript: ENSTBET00000011867
Sequence length 204
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_3030:212309:278309:1 gene:ENSTBEG00000011867 transcript:ENSTBET00000011867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELPAEPADAVRDGPSAQATRSEDRRTLLLRLRAQTKQQLLEYKSMIDANEENTPEQIM
QEKQIEAKIEDLENEIEEVKTNLEIKNLALDRVRLSNALQKNLEKIDVKNSVLIDNMNQV
LKLSKLIMKAQQESWDLEEKLLAVRKKRLQLKQASESKLLEIQTEKNKQKDDLDSMENSD
KIKSIQQNLQMEIQIATVIQHVFQ
Download sequence
Identical sequences ENSTBEP00000010270 ENSTBEP00000010270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]