SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010433 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010433
Domain Number 1 Region: 248-351
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.61e-19
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.00053
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000131
Family HLH, helix-loop-helix DNA-binding domain 0.0032
Further Details:      
 
Domain Number 3 Region: 93-159
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000838
Family Heme-binding PAS domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010433   Gene: ENSTBEG00000012008   Transcript: ENSTBET00000012048
Sequence length 748
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_830:42895:195451:1 gene:ENSTBEG00000012008 transcript:ENSTBET00000012048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEDEKDRAKRASRNKSEKKRRDQFNVLIKELSSMLPGNTRKMDKTTVLEKVIGFLQKHN
EVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHL
PSDVMDQNLLNFLPEQEHSEVYKMLSSHMLVTDPPSPEYLKSDNDLEFYCHLLRGSLNPK
EFPTYEYIKFVGNFRSYNNVPSPSCNGFDSTLSRPCRVPLGKEVCFIATVRLATPQFLKE
MCIVDEPLEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHIDDLELLPRCH
QHXXXXXXXXXXXYRFLTKGQQWIWLQTHYYITYHQWNSKPEFIVCTHSVVSYADVRVER
RQELALEDPPSEAIHPSALKDKGSSLEPQPHFNALDVGASGLTTTHSPSASSRSSHKSSP
TAMSEPNSTPTKLTAEASTTALPRSATLPQELPVPGLSQTATMPXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXFSAQFSMFQAIKDQLEQRTRILQANIRWQQEELHKIQEQLCLVQDS
SVQGPKLLRSSQVMQGGGRTLSSLTSPFSSATAVLPPTLSLTRASPDASQQPPDFSHRQL
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYPQSQAVFHNPDVHPASSSASTPVLLMG
QAVHHPSFPTSQPSSLQPAQAQQQQPQHYLQXXXXXXXXXXXQDSLLLSTYSQQGTLAYA
PPPPSQPPRPSRRVSSLSEPSSLQQPPR
Download sequence
Identical sequences ENSTBEP00000010433 ENSTBEP00000010433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]