SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000010782 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000010782
Domain Number 1 Region: 29-131
Classification Level Classification E-value
Superfamily FKBP-like 1.43e-35
Family FKBP immunophilin/proline isomerase 0.0000018
Further Details:      
 
Domain Number 2 Region: 256-368
Classification Level Classification E-value
Superfamily TPR-like 1.64e-21
Family Tetratricopeptide repeat (TPR) 0.00000108
Further Details:      
 
Domain Number 3 Region: 171-267
Classification Level Classification E-value
Superfamily FKBP-like 6.68e-18
Family FKBP immunophilin/proline isomerase 0.0000079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000010782   Gene: ENSTBEG00000012447   Transcript: ENSTBET00000012449
Sequence length 369
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_743:6872:72361:-1 gene:ENSTBEG00000012447 transcript:ENSTBET00000012449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTDEGAKNNGESPAAAVAERGEDITSKKDRGVLKVIKRVGNSEEKPMIGDKVYVHYKGK
LSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVSTMKKGEICHLLCKPEYAYGSAGSLP
KIPSNATLFFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLEGRCDGRM
FDCRDVVFVVGEGEDHDIPIGIDKALEKMQREEQCILCLGPRYGFGEAGKPKFGIEPNAE
LLYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYLQAVIQYGKIVSWLEM
EYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSATEKGLYRRGEA
QLLMNEFEA
Download sequence
Identical sequences ENSTBEP00000010782 ENSTBEP00000010782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]