SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011131 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011131
Domain Number 1 Region: 227-378
Classification Level Classification E-value
Superfamily ALDH-like 3.27e-52
Family ALDH-like 0.000000812
Further Details:      
 
Domain Number 2 Region: 2-189
Classification Level Classification E-value
Superfamily ALDH-like 1.44e-48
Family ALDH-like 0.000000354
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011131   Gene: ENSTBEG00000012850   Transcript: ENSTBET00000012846
Sequence length 378
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_5046:4655:31472:1 gene:ENSTBEG00000012850 transcript:ENSTBET00000012846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWHGSKSGKTFATYNPSTLKKICDVEEGDKPDVDKAVEAAQAAFQRGSPWRRLDA
LSRGRLLHQLADLVERDRAILATLETMDTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQG
RTIPTXXXXXXXXXXXXXXXXXXXXXWNFPLLMLLWKLAPALCCGNTVVLKPAEQTPLTA
LYLGSLIKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVGKLVKEAASRSN
LKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCCTAASRVFVEEPVYAEFVRR
SVEYARKRPVGDPFDGRTEQGPQIDQKQFNKILDLIESGKKEGAKLECGGSAMEDRGLFI
QPTVFSEVTDSMRIAKEE
Download sequence
Identical sequences ENSTBEP00000011131 ENSTBEP00000011131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]