SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011295 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011295
Domain Number 1 Region: 7-134
Classification Level Classification E-value
Superfamily DNA clamp 1.67e-16
Family DNA polymerase processivity factor 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011295   Gene: ENSTBEG00000013028   Transcript: ENSTBET00000013038
Sequence length 406
Comment pep:known_by_projection genescaffold:TREESHREW:GeneScaffold_1338:22377:131775:1 gene:ENSTBEG00000013028 transcript:ENSTBET00000013038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCEMSGSQVKVFGKAIQALSRISDDLWLDPSEKGLALRSVNSCRSAYGCVLFSPVFFE
QYQWSTSSKIDDNDTIVNLNCKMGMKSILLIFRCLTSLERNVEKCKIFTRSDKEKVVIQF
FCRHGIKRTHNIYFQESRPLQVIFEKNMCTNTLMIQPXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXLTNSVYSEMFVVPDEFDFFQIGVDTEITFCLKELKGMLIFSEATHA
PISIHFDFPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFSCMFFAVSSDKQEHFYPFDSLAKASDSEEDSHPTF
Download sequence
Identical sequences ENSTBEP00000011295 ENSTBEP00000011295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]