SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTBEP00000011296 from Tupaia belangeri 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTBEP00000011296
Domain Number 1 Region: 404-578,611-676
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 9.29e-50
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00044
Further Details:      
 
Domain Number 2 Region: 1124-1180
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 6.54e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 710-750
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000012
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTBEP00000011296   Gene: ENSTBEG00000013033   Transcript: ENSTBET00000013039
Sequence length 1180
Comment pep:novel genescaffold:TREESHREW:GeneScaffold_6066:375707:488893:1 gene:ENSTBEG00000013033 transcript:ENSTBET00000013039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSANPGNWVTFDDDSGFQSSQASKNLPLENQGVCRPNGLKLNLPGLKEFPSGSSSTSST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGIPGVPKAVTHVLYPIPESSSHCPLVIPADS
SLPTNPTTCLSHAFLPSDHSATHPAPKAGLPEDISSHQAERLGFQSSTPQFQYFREDYAF
SSPFWKEESSASQFTCDNPGSRKTLSSRDKELPIDQKSLNKCSLSYICEKLEHLQSAENQ
DSLGNLSTQCLYAEDVASSFVPHTLFRSQPRAGWSLMLRIPEKKNMMSSRQWGPIFLKVL
PGGILQMYYEKGLEKPFKELQLDPHCRLSEPKVENFSVAGKIHTVKIEHVSYTEKRKYHS
KTEVVHEPDIEQMLKLGSTEYHDFLDFLTTVEEELMKLPAVSKPKKNYEDQDITLEIVDN
FWGKVTKDEGKLIESTVITQISCLCFVNGNMECFLTLNDLELQKRDECYFEKDPEKKGIN
ILDYHFHNCVKVQEFEQSRIIKFAPPDACRFELMRFKTSYDGDALPFSVKSAVVVQGAYV
ELQAFVNMAPLTQRPSYMGSLRSCDNIMIHFPVPAQWIKALWTMNLQRQKSLKAKMNRRA
CLGSLHEPESEPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSPDYPHCLSYKLELGSDQ
EIPSDWDPFATVQFPMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKLYRSVIED
VIEGVRDLFAEEGIEEHVLKDLKQLWETKILQSKATEDFFRNSVHSSLFALQLPHSLHQT
LQSSTXXXXXXXXXXXXXXXXXXXGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNV
PIMVTQTSGGANILQHPIQHVFQQLGQPSVIQTGVPRLNPCSLQATTEKAQRMDMVLQQP
AALHSGPVDKKHLENASSDTLVPPGNEPKLVSEALLSQQGNSQFISLPGVTFPSQVSQTD
SNVEPVLGISDGMTQNLHGGPLTIGPLGALHQHMTDVQFHVLKNPVYDCESVKQPRNTEE
ASSIAVSQKGSNSQMDLSIQVTGDYINEIIQIDGTDDTSSNEEIESIKDVDENEFLGITD
AGDRKVLEEADSVSNEDSTANSSDNEDHHIDIVEEDPLNSGDDVSEQDVPDLFDTDNVIV
CQYDKVHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences ENSTBEP00000011296 ENSTBEP00000011296

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]